Structure of PDB 7zrs Chain BI

Receptor sequence

>7zrsBI (length=218) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAA

3D structure

PDB

7zrs Structural basis for clearing of ribosome collisions by the RQT complex.

Chain

Resolution

4.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	Y11 E56 L57 I131 K202 G204 L206	Y10 E55 L56 I130 K201 G203 L205
BS02	rna	BI	R3 R4 A6 R7 K13 N14 K15 Y22 R24 Y34 D35 K39 K40 E63 A64 A67 K74 R90 H92 F94 R98 N100 G107 A108 D109 R110 G114 M115 R116 W119 G120 Y157 K158 P160 G194 F196 K198	R2 R3 A5 R6 K12 N13 K14 Y21 R23 Y33 D34 K38 K39 E62 A63 A66 K73 R89 H91 F93 R97 N99 G106 A107 D108 R109 G113 M114 R115 W118 G119 Y156 K157 P159 G193 F195 K197

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zrs, PDBe:7zrs, PDBj:7zrs
PDBsum	7zrs
PubMed	36801861
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]