Structure of PDB 7pil Chain BI

Receptor sequence

>7pilBI (length=43) Species: 272943 (Cereibacter sphaeroides 2.4.1)

LGYTGLTDEQAQELHSVYMSGLWLFSAVAIVAHLAVYIWRPWF

3D structure

• PDB: 7pil Cryo-EM structure of the monomeric Rhodobacter sphaeroides RC-LH1 core complex at 2.5 angstrom.
• Chain: BI
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BCL	BI	F30 V33 A34 A37 H38	F25 V28 A29 A32 H33
BS02	SPO	BI	L19 V22 Y23 G26 L27	L14 V17 Y18 G21 L22
BS03	BCL	BI	Y23 L27 F48	Y18 L22 F43
BS04	BCL	BI	F30 A34 I35 H38 V41 W47	F25 A29 I30 H33 V36 W42

Gene Ontology

Molecular Function

• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity

Biological Process

• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex

External links

• PDB: RCSB:7pil, PDBe:7pil, PDBj:7pil
• PDBsum: 7pil
• PubMed: 34590677
• UniProt: Q3J1A3|LHB1_CERS4 Light-harvesting protein B-875 beta chain (Gene Name=pufB)