Structure of PDB 7pbw Chain BI

Receptor sequence
>7pbwBI (length=47) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
LNKVWPSGLTVAEAEEVHKQLILGTRVFGGMALIAHFLAAAATPWLG
3D structure
PDB7pbw Cryo-EM Structure of the Rhodobacter sphaeroides Light-Harvesting 2 Complex at 2.1 angstrom.
ChainBI
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL BI V31 M35 V27 M31
BS02 7OT BI E20 Q24 G28 T29 F32 E16 Q20 G24 T25 F28
BS03 BCL BI I26 T29 R30 I22 T25 R26
BS04 BCL BI F32 M35 A36 A39 H40 F28 M31 A32 A35 H36
BS05 BCL BI T29 F32 G33 H40 W49 T25 F28 G29 H36 W45
BS06 CA BI A44 T47 P48 W49 G51 A40 T43 P44 W45 G47
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pbw, PDBe:7pbw, PDBj:7pbw
PDBsum7pbw
PubMed34699186
UniProtQ3J145|LHB2_CERS4 Light-harvesting protein B-800/850 beta chain (Gene Name=pucB)

[Back to BioLiP]