Structure of PDB 7o1c Chain BI

Receptor sequence
>7o1cBI (length=66) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD
VATGGRVDRFNKRFNI
3D structure
PDB7o1c Structural basis for the tryptophan sensitivity of TnaC-mediated ribosome stalling.
ChainBI
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BI R59 R63 R59 R63
BS02 rna BI M1 K2 H6 M1 K2 H6
BS03 ZN BI C16 C18 C40 C16 C18 C40
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006413 translational initiation
GO:1904689 negative regulation of cytoplasmic translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o1c, PDBe:7o1c, PDBj:7o1c
PDBsum7o1c
PubMed34504068
UniProtP0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]