Structure of PDB 5o61 Chain BI

Receptor sequence

>5o61BI (length=126) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

PIQTVGRRKEAVVRVRLVPGTGQFNLDGRTLENYFPNKVHQQLIKAPLVT
VDRVDQFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKKAGFL
TRDPRAIERKKYGLKKARKAPQYSKR

3D structure

• PDB: 5o61 The Complete Structure of the Mycobacterium smegmatis 70S Ribosome.
• Chain: BI
• Resolution: 3.31 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	Q27 V29 R31 R32 K33 E34 R38 R40 R53 H86 D88 G90 G91 S93 G94 R105 R115 K119 T125 R126 R129 A130 E132 K134 K135 Y136 K139 K140 A141 R142 K143 Q146 Y147	Q3 V5 R7 R8 K9 E10 R14 R16 R29 H62 D64 G66 G67 S69 G70 R81 R91 K95 T101 R102 R105 A106 E108 K110 K111 Y112 K115 K116 A117 R118 K119 Q122 Y123
BS02	rna	BI	K149 R150	K125 R126

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5o61, PDBe:5o61, PDBj:5o61
• PDBsum: 5o61
• PubMed: 28683309
• UniProt: A0QSP9|RS9_MYCS2 Small ribosomal subunit protein uS9 (Gene Name=rpsI)