Structure of PDB 5el5 Chain BI

Receptor sequence

>5el5BI (length=97) Species: 300852 (Thermus thermophilus HB8)

NLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRK
AESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLS

3D structure

• PDB: 5el5 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
• Chain: BI
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	L10 A12 K14 R15 H16 Q18 S19 R22 R23 N26 K27 A28 K29 S31 A32 T35 L36 K38 K39 E51 K54 R57 E60 S61 D64 K65 K68 S70 K74 N75 A78 R79 K81 S82 R83 M85 R89 G102 G103 L104 S105	L2 A4 K6 R7 H8 Q10 S11 R14 R15 N18 K19 A20 K21 S23 A24 T27 L28 K30 K31 E43 K46 R49 E52 S53 D56 K57 K60 S62 K66 N67 A70 R71 K73 S74 R75 M77 R81 G94 G95 L96 S97
BS02	MG	BI	T35 K38	T27 K30

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5el5, PDBe:5el5, PDBj:5el5
• PDBsum: 5el5
• PubMed: 26791911
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)