Structure of PDB 4wsd Chain BI

Receptor sequence

>4wsdBI (length=99) Species: 300852 (Thermus thermophilus HB8)

RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA

3D structure

• PDB: 4wsd Structural insights into the translational infidelity mechanism.
• Chain: BI
• Resolution: 2.95 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	L10 A12 R15 S19 R22 R23 N26 K27 A28 S31 A32 T35 L36 K38 K39 E51 R57 E60 S61 K65 K68 S70 K74 N75 A78 R79 K81 S82 R83 M85 R89 G102 G103 L104 S105 A106	L3 A5 R8 S12 R15 R16 N19 K20 A21 S24 A25 T28 L29 K31 K32 E44 R50 E53 S54 K58 K61 S63 K67 N68 A71 R72 K74 S75 R76 M78 R82 G95 G96 L97 S98 A99

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wsd, PDBe:4wsd, PDBj:4wsd
• PDBsum: 4wsd
• PubMed: 26037619
• UniProt: P80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)