Structure of PDB 4v82 Chain BI

Receptor sequence
>4v82BI (length=35) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK
3D structure
PDB4v82 Structural basis of cyanobacterial photosystem II Inhibition by the herbicide terbutryn
ChainBI
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA BI V5008 Y5009 V5011 V5012 F5015 V8 Y9 V11 V12 F15
BS02 CLA BI F5019 F5023 F19 F23
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v82, PDBe:4v82, PDBj:4v82
PDBsum4v82
PubMed21367867
UniProtQ8DJZ6|PSBI_THEVB Photosystem II reaction center protein I (Gene Name=psbI)

[Back to BioLiP]