Structure of PDB 4v7i Chain BI

Receptor sequence

>4v7iBI (length=127) Species: 83333 (Escherichia coli K-12)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 4v7i Regulation of the protein-conducting channel by a bound ribosome.
• Chain: BI
• Resolution: 9.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	N3 Q4 Y5 Y6 T8 R10 R11 K12 S13 A15 R17 F19 K21 R40 E41 Y63 K67 G68 G69 G70 I71 S72 Q74 R84 S95 R98 K99 V103 T104 R105 D106 R108 Q109 V110 E111 K113 V115 R118 K119 A120 R121 R122 R123 P124 Q125 F126 S127 K128 R129	N1 Q2 Y3 Y4 T6 R8 R9 K10 S11 A13 R15 F17 K19 R38 E39 Y61 K65 G66 G67 G68 I69 S70 Q72 R82 S93 R96 K97 V101 T102 R103 D104 R106 Q107 V108 E109 K111 V113 R116 K117 A118 R119 R120 R121 P122 Q123 F124 S125 K126 R127

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7i, PDBe:4v7i, PDBj:4v7i
• PDBsum: 4v7i
• PubMed: 19913480
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)