Structure of PDB 4v6u Chain BI

Receptor sequence

>4v6uBI (length=142) Species: 186497 (Pyrococcus furiosus DSM 3638)

MRIINAEGLILGRLASKVAKMLLEGEEVVIVNAEKAVITGNRDVIFKKYK
QRTELRTLTNPRRGPFYPKRSDEIVRRTIRGMLPWKTDRGRKAFKRLKVY
VGIPKEFQGKELETIIEAHVSRLSRPKYVTVGEVAKFLGGKF

3D structure

• PDB: 4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
• Chain: BI
• Resolution: 6.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	I10 G12 R13 S16 K17 K20 I38 T39 K48 K50 R52 L55 R56 L58 N60 R62 R63 G64 P65 F66 Y67 P68 K69 R70 E73 R76 T78 R80 M82 W85 K86 D88 F94 K95 V99 I116 E117 R125 K127 F137	I10 G12 R13 S16 K17 K20 I38 T39 K48 K50 R52 L55 R56 L58 N60 R62 R63 G64 P65 F66 Y67 P68 K69 R70 E73 R76 T78 R80 M82 W85 K86 D88 F94 K95 V99 I116 E117 R125 K127 F137

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
• PDBsum: 4v6u
• PubMed: 23222135
• UniProt: Q8U0E6|RL13_PYRFU Large ribosomal subunit protein uL13 (Gene Name=rpl13)