Structure of PDB 4v6k Chain BI

Receptor sequence
>4v6kBI (length=166) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
AHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYG
KAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASE
GTGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPE
MVAAKRGKSVEEILGK
3D structure
PDB4v6k Structural insights into cognate versus near-cognate discrimination during decoding.
ChainBI
Resolution8.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BI V20 S21 K22 T23 V24 K25 Y49 K51 R53 K61 H88 R92 I105 A106 G107 M110 L123 K125 Y127 T130 N131 N134 V20 S21 K22 T23 V24 K25 Y49 K51 R53 K61 H88 R92 I105 A106 G107 M110 L123 K125 Y127 T130 N131 N134
BS02 rna BI V17 R19 R28 F30 F32 V17 R19 R28 F30 F32
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6k, PDBe:4v6k, PDBj:4v6k
PDBsum4v6k
PubMed21378755
UniProtP0A7W1|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]