Structure of PDB 4v6i Chain BI

Receptor sequence

>4v6iBI (length=181) Species: 4932 (Saccharomyces cerevisiae)

MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCV
HLVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRIN
KMLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVE
GLRRARYKFPGQQKIILSKKWGFTNLDRPEY

3D structure

• PDB: 4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
• Chain: BI
• Resolution: 8.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	R24 A106 G107 L111 K121	R24 A106 G107 L111 K121
BS02	rna	BI	M1 R3 R4 P5 A6 R7 C8 R10 K13 N14 K15 P18 K19 R21 Y22 Y34 D35 K39 S61 K74 R88 V89 R90 H92 F94 L103 D109 R110 Q112 Q113 M115 G117 A118 W119 R153 R154 R156 Y157 K158 P160 Q162 K164	M1 R3 R4 P5 A6 R7 C8 R10 K13 N14 K15 P18 K19 R21 Y22 Y34 D35 K39 S61 K74 R88 V89 R90 H92 F94 L103 D109 R110 Q112 Q113 M115 G117 A118 W119 R153 R154 R156 Y157 K158 P160 Q162 K164
BS03	rna	BI	R10 E56	R10 E56

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
• PDBsum: 4v6i
• PubMed: 20980660
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)