Structure of PDB 4v55 Chain BI

Receptor sequence
>4v55BI (length=141) Species: 562 (Escherichia coli) [Search protein sequence]
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK
GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI
SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED
3D structure
PDB4v55 Structural basis for aminoglycoside inhibition of bacterial ribosome recycling.
ChainBI
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BI K9 L10 Q11 P74 A75 A76 S87 G88 G90 P92 N93 K94 K112 T117 G118 A119 A123 R126 S127 G130 T131 R133 S134 M135 K9 L10 Q11 P74 A75 A76 S87 G88 G90 P92 N93 K94 K112 T117 G118 A119 A123 R126 S127 G130 T131 R133 S134 M135
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006415 translational termination
GO:0015968 stringent response
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v55, PDBe:4v55, PDBj:4v55
PDBsum4v55
PubMed17660832
UniProtP0A7J7|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]