Structure of PDB 4v4n Chain BI

Receptor sequence
>4v4nBI (length=129) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence]
TLLDPLANALSHITNSERVGKREVYIKPASKLIGEVLRVMQKYGYIGEFE
FIDDGRAGVYRVQLLGRINKAGAIKPRFPVKVSEFEKWEKRFLPAFEFGI
LIVSTSQGVMSHKEAIEKGIGGRLIAYVY
3D structure
PDB4v4n Structure of the SecY channel during initiation of protein translocation.
ChainBI
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BI T2 L4 N9 S12 H13 N16 R19 K22 A30 K32 R57 K71 K76 P80 K82 V83 R92 F93 S105 T106 S107 G122 G123 R124 T1 L3 N8 S11 H12 N15 R18 K21 A29 K31 R56 K70 K75 P79 K81 V82 R91 F92 S104 T105 S106 G121 G122 R123
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sun Mar 9 08:59:32 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4n', asym_id = 'BI', title = 'Structure of the SecY channel during initiation of protein translocation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4n', asym_id='BI', title='Structure of the SecY channel during initiation of protein translocation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4n', asym_id = 'BI'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4n', asym_id='BI')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>