Structure of PDB 8oir Chain BH

Receptor sequence
>8oirBH (length=110) Species: 9606 (Homo sapiens) [Search protein sequence]
AAPKNRRTIEVNRCRRRNPQKLIKVKNNIDVCPECGHLKQKHVLCAYCYE
KVCKETAEIRRQIGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRIIERD
RKRPSWFTQN
3D structure
PDB8oir Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
ChainBH
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BH A79 A80 P81 K82 N83 R84 R85 T86 I87 V89 N90 R91 C92 R93 R94 R95 N96 P97 Q98 K99 N106 H120 A135 R138 R139 G142 F149 A1 A2 P3 K4 N5 R6 R7 T8 I9 V11 N12 R13 C14 R15 R16 R17 N18 P19 Q20 K21 N28 H42 A57 R60 R61 G64 F71
BS02 ZN BH C110 C123 C32 C45
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8oir, PDBe:8oir, PDBj:8oir
PDBsum8oir
PubMed37141370
UniProtQ9BYC8|RM32_HUMAN Large ribosomal subunit protein bL32m (Gene Name=MRPL32)

[Back to BioLiP]