Structure of PDB 4v92 Chain BH

Receptor sequence

>4v92BH (length=184) Species: 28985 (Kluyveromyces lactis)

PQAKILSQAPTELELQVAQAFVELENSSPELKAELRPLQFKSIREIDVAG
GKKALAIFVPVPSLAGFHKVQTKLTRELEKKFQDRHVIFLAERRILPKPS
RTSRQVQKRPRSRTLTAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVL
LDSKDVQQIDYKLESFQAVYNKLTGKQIVFEIPS

3D structure

• PDB: 4v92 Initiation of Translation by Cricket Paralysis Virus Ires Requires its Translocation in the Ribosome.
• Chain: BH
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BH	P100 K101 P102 S103 R104 T105 S106 R107 Q108 V109 Q110 K111 R112 G137 K138	P97 K98 P99 S100 R101 T102 S103 R104 Q105 V106 Q107 K108 R109 G134 K135

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 04:52:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v92', asym_id = 'BH', title = 'Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v92', asym_id='BH', title='Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v92', asym_id = 'BH'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v92', asym_id='BH')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>