Structure of PDB 4v8u Chain BH

Receptor sequence
>4v8uBH (length=166) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRH
KSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSH
PVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKG
IYYAGEPVRLKPGKAG
3D structure
PDB4v8u Crystal structure of 70S ribosome with both cognate tRNAs in the E and P sites representing an authentic elongation complex.
ChainBH
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BH R59 K62 S63 L67 G108 F109 S110 K138 Q139 G142 Q143 Y157 H158 K160 A176 G177 R48 K51 S52 L56 G97 F98 S99 K127 Q128 G131 Q132 Y146 H147 K149 A165 G166
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Mar 11 00:42:27 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v8u', asym_id = 'BH', title = 'Crystal structure of 70S ribosome with both cogn...tes representing an authentic elongation complex.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v8u', asym_id='BH', title='Crystal structure of 70S ribosome with both cogn...tes representing an authentic elongation complex.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v8u', asym_id = 'BH'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v8u', asym_id='BH')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>