Structure of PDB 4v82 Chain BH

Receptor sequence
>4v82BH (length=65) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNS
TLILDGVNVSWKALG
3D structure
PDB4v82 Structural basis of cyanobacterial photosystem II Inhibition by the herbicide terbutryn
ChainBH
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA BH F5038 F5041 L5046 Y5049 F37 F40 L45 Y48
BS02 CLA BH F5038 L5039 F37 L38
BS03 CLA BH T5027 M5031 F5034 M5035 T26 M30 F33 M34
BS04 CLA BH T5005 L5007 G5008 T4 L6 G7
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v82, PDBe:4v82, PDBj:4v82
PDBsum4v82
PubMed21367867
UniProtQ8DJ43|PSBH_THEVB Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]