Structure of PDB 4v7l Chain BH

Receptor sequence
>4v7lBH (length=163) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSD
ERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTV
GFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAY
HEKGIYYAGEPVR
3D structure
PDB4v7l The structures of the anti-tuberculosis antibiotics viomycin and capreomycin bound to the 70S ribosome.
ChainBH
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BH R59 K62 S63 L64 L67 T70 N74 G108 F109 S110 H111 Q139 G142 Q143 K160 R52 K55 S56 L57 L60 T63 N67 G101 F102 S103 H104 Q132 G135 Q136 K153
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Mar 10 18:36:07 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7l', asym_id = 'BH', title = 'The structures of the anti-tuberculosis antibiot...omycin and capreomycin bound to the 70S ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7l', asym_id='BH', title='The structures of the anti-tuberculosis antibiot...omycin and capreomycin bound to the 70S ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v7l', asym_id = 'BH'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v7l', asym_id='BH')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>