Structure of PDB 4v7k Chain BH

Receptor sequence

>4v7kBH (length=164) Species: 300852 (Thermus thermophilus HB8)

LPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPS
DERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELT
VGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSA
YHEKGIYYAGEPVR

3D structure

• PDB: 4v7k The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
• Chain: BH
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BH	R59 K62 S63 G66 L67 T70 G108 S110 K138 Q139 G142 Q143 A146 R152 K160	R53 K56 S57 G60 L61 T64 G102 S104 K132 Q133 G136 Q137 A140 R146 K154

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Feb 20 07:20:50 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7k', asym_id = 'BH', title = 'The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7k', asym_id='BH', title='The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v7k', asym_id = 'BH'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v7k', asym_id='BH')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>