Structure of PDB 4v5k Chain BH

Receptor sequence
>4v5kBH (length=164) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
LPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPS
DERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELT
VGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSA
YHEKGIYYAGEPVR
3D structure
PDB4v5k Structural Basis for 16S Ribosomal RNA Cleavage by the Cytotoxic Domain of Colicin E3.
ChainBH
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BH R59 K62 S63 G66 L67 T70 F109 S110 Q139 G142 Q143 E159 K160 R53 K56 S57 G60 L61 T64 F103 S104 Q133 G136 Q137 E153 K154
BS02 MG BH L7 P8 L1 P2
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Mar 10 05:26:00 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5k', asym_id = 'BH', title = 'Structural Basis for 16S Ribosomal RNA Cleavage by the Cytotoxic Domain of Colicin E3.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5k', asym_id='BH', title='Structural Basis for 16S Ribosomal RNA Cleavage by the Cytotoxic Domain of Colicin E3.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v5k', asym_id = 'BH'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v5k', asym_id='BH')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>