Structure of PDB 4v5g Chain BH

Receptor sequence
>4v5gBH (length=159) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRH
KSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSH
PVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKG
IYYAGEPVR
3D structure
PDB4v5g The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.
ChainBH
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BH R59 K62 S63 L67 N74 F109 S110 Q139 G142 Q143 K160 R170 R48 K51 S52 L56 N63 F98 S99 Q128 G131 Q132 K149 R159
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Nov 27 00:05:45 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v5g', asym_id = 'BH', title = 'The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v5g', asym_id='BH', title='The crystal structure of the ribosome bound to EF-Tu and aminoacyl-tRNA.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v5g', asym_id = 'BH'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v5g', asym_id='BH')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>