Structure of PDB 4v4p Chain BH

Receptor sequence
>4v4pBH (length=150) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLA
VQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGA
VPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
3D structure
PDB4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
ChainBH
Resolution5.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna BH R14 T16 A17 R18 M19 Q20 A21 G22 R24 R25 R27 F45 K47 P49 G85 A86 A102 G103 T120 K121 E122 L123 S125 R126 N127 N130 R10 T12 A13 R14 M15 Q16 A17 G18 R20 R21 R23 F41 K43 P45 G81 A82 A98 G99 T116 K117 E118 L119 S121 R122 N123 N126
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v4p, PDBe:4v4p, PDBj:4v4p
PDBsum4v4p
PubMed15802605
UniProtQ5SHQ5|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]