Structure of PDB 1vy4 Chain BH

Receptor sequence
>1vy4BH (length=174) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVR
VERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGR
ALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAI
RKPSAYHEKGIYYAGEPVRLKPGK
3D structure
PDB1vy4 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.
ChainBH
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BH S2 R3 I4 R59 K62 S63 G66 L67 T70 N74 K85 F109 S110 H111 K138 Q139 G142 Q143 R152 Y157 H158 K172 K175 S1 R2 I3 R58 K61 S62 G65 L66 T69 N73 K84 F108 S109 H110 K137 Q138 G141 Q142 R151 Y156 H157 K171 K174
BS02 MG BH N74 Y83 I136 D137 K138 N73 Y82 I135 D136 K137
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1vy4, PDBe:1vy4, PDBj:1vy4
PDBsum1vy4
PubMed25132179
UniProtP0DOY8|RL6_THET8 Large ribosomal subunit protein uL6 (Gene Name=rplF)

[Back to BioLiP]