Structure of PDB 8oeq Chain BG

Receptor sequence

>8oeqBG (length=200) Species: 5476 (Candida albicans) [Search protein sequence]

AISKNLPLLNNHFRKHWQERVRVHFDQAGKKASRRQSRLRKAAKIAPRPI
DALRPVVRAPTVKYNRKVRAGRGFTLAELKAVGIAPKYARTIGISVDHRR
QNKSQETFDANVARLQEYKSKLVIFDKKTKASEVASFEQVDVSATFPVEQ
PAPESGLRAVEVPEQTAYRTLRLARNEKKYKGIREKRAKEKAEAEAEKAK

3D structure

PDB

8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BG	K131 S133	K130 S132
BS02	rna	BG	A2 I3 K5 L7 N11 N12 H13 F14 R15 K16 H17 W18 Q19 R23 Q28 A29 K31 K32 R35 R36 R39 K45 R55 V58 R59 A60 P61 T62 V63 Y65 N66 K68 R70 G72 R73 L77 K88 R91 D98 H99 R100 R101 S105 K128 Y169 R173 R176 N177 K179 K180 Y181 G183 R185 K187 R188	A1 I2 K4 L6 N10 N11 H12 F13 R14 K15 H16 W17 Q18 R22 Q27 A28 K30 K31 R34 R35 R38 K44 R54 V57 R58 A59 P60 T61 V62 Y64 N65 K67 R69 G71 R72 L76 K87 R90 D97 H98 R99 R100 S104 K127 Y168 R172 R175 N176 K178 K179 Y180 G182 R184 K186 R187
BS03	rna	BG	F26 D27	F25 D26
BS04	MG	BG	A29 G30	A28 G29

External links

PDB	RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
PDBsum	8oeq
PubMed
UniProt	A0A8H6F5V7

[Back to BioLiP]