Structure of PDB 7wfe Chain BG

Receptor sequence
>7wfeBG (length=94) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
ELSPSIVISLSTGLSLFLGRFVFFNFQRENVAKQGLPEQNGKTHFEAGDD
RAKEYVSLLKSNDPIGFNIVDVLAWGSIGHIVAYYILATSSNGY
3D structure
PDB7wfe Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
ChainBG
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA BG Y145 A148 T149 N152 Y85 A88 T89 N92
BS02 CLA BG F86 Q87 N90 V91 Q94 F26 Q27 N30 V31 Q34
BS03 CLA BG Q94 Y145 Q34 Y85
BS04 CLA BG S65 I68 S69 H140 S5 I8 S9 H80
BS05 CLA BG R80 N122 D123 F127 I129 V132 R20 N62 D63 F67 I69 V72
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0009773 photosynthetic electron transport in photosystem I
GO:0009780 photosynthetic NADP+ reduction
GO:0015979 photosynthesis
GO:0042550 photosystem I stabilization
GO:0050821 protein stabilization
Cellular Component
GO:0005634 nucleus
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0009941 chloroplast envelope
GO:0016020 membrane
GO:0030093 chloroplast photosystem I
GO:0031969 chloroplast membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wfe, PDBe:7wfe, PDBj:7wfe
PDBsum7wfe
PubMed35123031
UniProtQ9S7N7|PSAG_ARATH Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]