Structure of PDB 7lh5 Chain BG

Receptor sequence

>7lh5BG (length=178) Species: 300852 (Thermus thermophilus HB8)

DVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARIL
EKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFL
EKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALR
GMDIAVVTTAETDEEARALLELLGFPFR

3D structure

• PDB: 7lh5 Structural basis for plazomicin antibiotic action and resistance.
• Chain: BG
• Resolution: 3.27 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	S76 S78	S73 S75
BS02	rna	BG	K36 N40 G42 L43 T71 A73 K74 R91 S124 D126 R128 N130 N132 L133 G134 L135 G154 M155 D156	K33 N37 G39 L40 T68 A70 K71 R88 S121 D123 R125 N127 N129 L130 G131 L132 G151 M152 D153
BS03	rna	BG	N27 W29 E30 Q66 K67 A69 V70 R72 V92 T93 R95 R96 R98	N24 W26 E27 Q63 K64 A66 V67 R69 V89 T90 R92 R93 R95

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7lh5, PDBe:7lh5, PDBj:7lh5
• PDBsum: 7lh5
• PubMed: 34117352
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)