Structure of PDB 7am2 Chain BG |
>7am2BG (length=85) Species: 5689 (Leishmania tarentolae) [Search protein sequence] |
NACHVPGDQIFLVSNSFTRRLLTRTDHCPKCDRLSTFRFMSVSGMVGRMP YKPVDTPGPSYATLYWRKQRSGKIASQPLNEVCNK |
|
PDB | 7am2 Structure of the mature kinetoplastids mitoribosome and insights into its large subunit biogenesis. |
Chain | BG |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
BG |
R1278 T1295 K1311 |
R19 T36 K52 |
|
|
|
|