Structure of PDB 6tb3 Chain BG

Receptor sequence

>6tb3BG (length=127) Species: 559292 (Saccharomyces cerevisiae S288C)

ASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNIS
QPKIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNIS
AKNRVVILARAKALGIKVTNPKGRLAL

3D structure

• PDB: 6tb3 The Ccr4-Not complex monitors the translating ribosome for codon optimality.
• Chain: BG
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	A2 K8 K11 K12 T14 K15 F17 R19 H20 H21 D23 R24 Y25 H26 R27 V28 N31 W32 R33 K34 Q35 K36 G37 I38 D39 S40 R43 R44 R45 F46 R47 P53 K54 I55 G56 Y57 G58 S59 N60 K61 K62 K64 F65 P68 L75 A97 H98 N99 I100 S101 N104 R105 K118 N121 R125	A1 K7 K10 K11 T13 K14 F16 R18 H19 H20 D22 R23 Y24 H25 R26 V27 N30 W31 R32 K33 Q34 K35 G36 I37 D38 S39 R42 R43 R44 F45 R46 P52 K53 I54 G55 Y56 G57 S58 N59 K60 K61 K63 F64 P67 L74 A96 H97 N98 I99 S100 N103 R104 K117 N120 R124
BS02	MG	BG	S22 Y25 H26 V28	S21 Y24 H25 V27

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6tb3, PDBe:6tb3, PDBj:6tb3
• PDBsum: 6tb3
• PubMed: 32299921
• UniProt: P38061|RL32_YEAST Large ribosomal subunit protein eL32 (Gene Name=RPL32)