Structure of PDB 4v9s Chain BG

Receptor sequence

>4v9sBG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v9s The antibiotics dityromycin and GE82832 bind protein S12 and block EF-G-catalyzed translocation.
• Chain: BG
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	S76 S78	S75 S77
BS02	rna	BG	K36 V38 N40 G42 L43 G44 E45 K47 T71 A73 K74 K75 I77 N79 F80 I88 S124 D126 R128 N132 L135 G154 M155 D156	K35 V37 N39 G41 L42 G43 E44 K46 T70 A72 K73 K74 I76 N78 F79 I87 S123 D125 R127 N131 L134 G153 M154 D155
BS03	rna	BG	P2 N27 W29 E30 Q66 K67 A69 V70 R72 R91 V92 T93 R95 R96 R98	P1 N26 W28 E29 Q65 K66 A68 V69 R71 R90 V91 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9s, PDBe:4v9s, PDBj:4v9s
• PDBsum: 4v9s
• PubMed: 24412368
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)