Structure of PDB 4v9k Chain BG

Receptor sequence
>4v9kBG (length=181) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK
3D structure
PDB4v9k Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainBG
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BG N40 G42 G44 A73 K74 I77 N79 S124 D126 R128 N132 L133 G154 M155 D156 N39 G41 G43 A72 K73 I76 N78 S123 D125 R127 N131 L132 G153 M154 D155
BS02 rna BG N27 W29 E30 K67 A69 T71 R91 T93 R95 N26 W28 E29 K66 A68 T70 R90 T92 R94
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9k, PDBe:4v9k, PDBj:4v9k
PDBsum4v9k
PubMed23812722
UniProtQ5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]