Structure of PDB 4v92 Chain BG

Receptor sequence

>4v92BG (length=226) Species: 28985 (Kluyveromyces lactis)

MKLNISYPVNGSQKTFEIDDEHRIRVFFDARIGQEVDGEAVGDEFKGYVF
KISGGNDKQGFPMKQGVLLPTRIALLLTKNVSCYRPRRDGERKRKSVRGA
IVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKE
DDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQA
QREAAAEYAQLLAKRLSERKAEKAEI

3D structure

• PDB: 4v92 Initiation of Translation by Cricket Paralysis Virus Ires Requires its Translocation in the Ribosome.
• Chain: BG
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	M1 K2 L3 N4 I5 S6 Y7 P8 V9 N10 G11 S12 Q13 K14 T15 F16 E17 F27 D29 A30 R31 I32 G33 Q34 V49 K51 I52 S53 G54 N56 D57 K58 M63 K64 Q65 G66 V67 L68 L69 P70 T71 R72 I73 A74 L75 L76 S82 C83 Y84 R85 P86 R87 R88 D89 G90 E91 R92 K93 R94 V97 R98 G99 A100 I101 V102 L106 A107 V108 L109 A110 V112 I113 V114 K115 K116 G123 L124 V129 K131 R132 L133 G134 P135 K136 R137 A138 N139 N140 I141 R142 K143 F144 V153 R154 D155 F156 V157 I158 R160 E161 V162 T163 K164 G165 E166 K167 T168 Y169 K171 P173 K174 I175 Q176 R177 L178 V179 Q182 R183 L184 Q185 R186 K187 R188 H189 Q190 R191 K194 V195 Q201 R202 E203 A204 A205 A206 E207 Y208 A209 Q210 L211 L212 A213 R215 L216 S217 E218 R219 K220	M1 K2 L3 N4 I5 S6 Y7 P8 V9 N10 G11 S12 Q13 K14 T15 F16 E17 F27 D29 A30 R31 I32 G33 Q34 V49 K51 I52 S53 G54 N56 D57 K58 M63 K64 Q65 G66 V67 L68 L69 P70 T71 R72 I73 A74 L75 L76 S82 C83 Y84 R85 P86 R87 R88 D89 G90 E91 R92 K93 R94 V97 R98 G99 A100 I101 V102 L106 A107 V108 L109 A110 V112 I113 V114 K115 K116 G123 L124 V129 K131 R132 L133 G134 P135 K136 R137 A138 N139 N140 I141 R142 K143 F144 V153 R154 D155 F156 V157 I158 R160 E161 V162 T163 K164 G165 E166 K167 T168 Y169 K171 P173 K174 I175 Q176 R177 L178 V179 Q182 R183 L184 Q185 R186 K187 R188 H189 Q190 R191 K194 V195 Q201 R202 E203 A204 A205 A206 E207 Y208 A209 Q210 L211 L212 A213 R215 L216 S217 E218 R219 K220

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 05:11:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v92', asym_id = 'BG', title = 'Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v92', asym_id='BG', title='Initiation of Translation by Cricket Paralysis V... Ires Requires its Translocation in the Ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v92', asym_id = 'BG'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v92', asym_id='BG')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>