Structure of PDB 4v90 Chain BG

Receptor sequence

>4v90BG (length=179) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

DVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARIL
EKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFL
EKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALR
GMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

PDB

4v90 Structure of EF-G-ribosome complex in a pretranslocation state.

Chain

Resolution

2.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	K36 N40 Q41 L43 G44 E45 K47 T71 A73 K74 K75 N79 F80 K84 S124 D126 Y131 N132 L133 G134 L135 R136 E137 M155 D156 V160	K33 N37 Q38 L40 G41 E42 K44 T68 A70 K71 K72 N76 F77 K81 S121 D123 Y128 N129 L130 G131 L132 R133 E134 M152 D153 V157
BS02	rna	BG	N27 W29 K67 P68 A69 V70 R72 R91 V92 T93 L94 R95 R96	N24 W26 K64 P65 A66 V67 R69 R88 V89 T90 L91 R92 R93

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v90, PDBe:4v90, PDBj:4v90
PDBsum	4v90
PubMed	23912278
UniProt	Q5SHQ0\|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]