Structure of PDB 4v8u Chain BG

Receptor sequence
>4v8uBG (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK
3D structure
PDB4v8u Crystal structure of 70S ribosome with both cognate tRNAs in the E and P sites representing an authentic elongation complex.
ChainBG
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BG S76 S78 S75 S77
BS02 rna BG V38 N40 L43 E45 T71 R72 A73 K74 K75 N79 S124 D126 R128 N132 L135 R136 G154 V37 N39 L42 E44 T70 R71 A72 K73 K74 N78 S123 D125 R127 N131 L134 R135 G153
BS03 rna BG N27 W29 Q66 K67 A69 V70 V92 T93 R95 R96 N26 W28 Q65 K66 A68 V69 V91 T92 R94 R95
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8u, PDBe:4v8u, PDBj:4v8u
PDBsum4v8u
PubMed23527033
UniProtQ5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]