Structure of PDB 4v8g Chain BG

Receptor sequence

>4v8gBG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v8g How hibernation factors RMF, HPF, and YfiA turn off protein synthesis.
• Chain: BG
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	K36 N40 L43 G44 K47 T71 F80 I88 S124 D126 R128 N132 L133 G134 L135 R153 G154 M155 D156	K35 N39 L42 G43 K46 T70 F79 I87 S123 D125 R127 N131 L132 G133 L134 R152 G153 M154 D155
BS02	rna	BG	P2 N27 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R96 R98	P1 N26 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8g, PDBe:4v8g, PDBj:4v8g
• PDBsum: 4v8g
• PubMed: 22605777
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)