Structure of PDB 4v8f Chain BG

Receptor sequence

>4v8fBG (length=208) Species: 300852 (Thermus thermophilus HB8)

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

• PDB: 4v8f A new understanding of the decoding principle on the ribosome.
• Chain: BG
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	G2 R3 I5 P7 V8 C9 R10 R13 R14 K22 G23 E24 R25 R35 R36 Y38 P40 G41 Q42 H43 R49 S52 Y54 A55 L58 R59 K61 Q62 E72 R73 Q74 N77 K86 S113 Q116 R118 Q119 R122 H123 H125 R132 L135 S137 K151 L155 E205 S208 R209	G1 R2 I4 P6 V7 C8 R9 R12 R13 K21 G22 E23 R24 R34 R35 Y37 P39 G40 Q41 H42 R48 S51 Y53 A54 L57 R58 K60 Q61 E71 R72 Q73 N76 K85 S112 Q115 R117 Q118 R121 H122 H124 R131 L134 S136 K150 L154 E204 S207 R208
BS02	ZN	BG	K22 C31	K21 C30
BS03	OHX	BG	S83 K85 G87 T89	S82 K84 G86 T88

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8f, PDBe:4v8f, PDBj:4v8f
• PDBsum: 4v8f
• PubMed: 22437501
• UniProt: P80373|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)