Structure of PDB 4v7x Chain BG

Receptor sequence
>4v7xBG (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK
3D structure
PDB4v7x Revisiting the structures of several antibiotics bound to the bacterial ribosome.
ChainBG
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BG N40 L43 G44 T71 K74 K75 N79 G89 R91 S124 R128 N132 L133 G134 L135 R153 G154 M155 N39 L42 G43 T70 K73 K74 N78 G88 R90 S123 R127 N131 L132 G133 L134 R152 G153 M154
BS02 rna BG N27 V28 W29 Q66 K67 A69 V70 T71 V92 T93 R95 N26 V27 W28 Q65 K66 A68 V69 T70 V91 T92 R94
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7x, PDBe:4v7x, PDBj:4v7x
PDBsum4v7x
PubMed20876130
UniProtQ5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]