Structure of PDB 4v7m Chain BG

Receptor sequence

>4v7mBG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v7m The structures of the anti-tuberculosis antibiotics viomycin and capreomycin bound to the 70S ribosome.
• Chain: BG
• Resolution: 3.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	S76 I77 S78	S75 I76 S77
BS02	rna	BG	K36 N40 L43 T71 A73 K74 K75 N79 S124 R128 N130 N132 L133 G134 G154 M155 D156	K35 N39 L42 T70 A72 K73 K74 N78 S123 R127 N129 N131 L132 G133 G153 M154 D155
BS03	rna	BG	L3 N27 W29 Q66 K67 A69 V70 T71 R72 R91 V92 T93 R95 R96	L2 N26 W28 Q65 K66 A68 V69 T70 R71 R90 V91 T92 R94 R95

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7m, PDBe:4v7m, PDBj:4v7m
• PDBsum: 4v7m
• PubMed: 20154709
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)