Structure of PDB 4v7j Chain BG

Receptor sequence

>4v7jBG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v7j The structural basis for mRNA recognition and cleavage by the ribosome-dependent endonuclease RelE.
• Chain: BG
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	S78 R83 K84	S77 R82 K83
BS02	rna	BG	V38 N40 T71 R72 A73 K74 K75 I77 N79 R91 S124 R128 N132 G134 R136 G154 M155 D156 V160	V37 N39 T70 R71 A72 K73 K74 I76 N78 R90 S123 R127 N131 G133 R135 G153 M154 D155 V159
BS03	rna	BG	N27 W29 Q66 K67 A69 V70 R91 V92 T93 R95	N26 W28 Q65 K66 A68 V69 R90 V91 T92 R94

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v7j, PDBe:4v7j, PDBj:4v7j
• PDBsum: 4v7j
• PubMed: 20005802
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)