Structure of PDB 4v7i Chain BG

Receptor sequence

>4v7iBG (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

RRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQ
RSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMR
WIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFA

3D structure

PDB

4v7i Regulation of the protein-conducting channel by a bound ribosome.

Chain

Resolution

9.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	R2 R3 R4 V5 I6 G7 Q8 R9 K10 K24 N27 I28 L29 M30 V31 D32 G33 K34 K35 S36 T37 I41 R78 V79 G80 G81 R91 V93 R94 A97 L98 R101 K109 K113 S114 M115 R118	R1 R2 R3 V4 I5 G6 Q7 R8 K9 K23 N26 I27 L28 M29 V30 D31 G32 K33 K34 S35 T36 I40 R77 V78 G79 G80 R90 V92 R93 A96 L97 R100 K108 K112 S113 M114 R117

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0016020	membrane
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v7i, PDBe:4v7i, PDBj:4v7i
PDBsum	4v7i
PubMed	19913480
UniProt	P02359\|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]