Structure of PDB 4v6i Chain BG

Receptor sequence
>4v6iBG (length=176) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MSAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGK
RVVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEK
FNVEYFAKEKLTKKEKKEANLFPEQQNKEIKAERVEDQKVVDKALIAEIK
KTPLLKQYLSASFSLKNGDKPHMLKF
3D structure
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
ChainBG
Resolution8.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BG D14 A17 L18 K19 T21 R22 A25 K29 L42 R46 F47 G49 K50 V52 K56 H57 L58 P75 L76 R77 R82 Y83 E94 V96 N97 V98 E99 L111 G168 D169 D14 A17 L18 K19 T21 R22 A25 K29 L42 R46 F47 G49 K50 V52 K56 H57 L58 P75 L76 R77 R82 Y83 E94 V96 N97 V98 E99 L111 G168 D169
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum4v6i
PubMed20980660
UniProtQ02326|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)

[Back to BioLiP]