Structure of PDB 4v68 Chain BG

Receptor sequence

>4v68BG (length=181) Species: 274 (Thermus thermophilus)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v68 GTPase activation of elongation factor EF-Tu by the ribosome during decoding
• Chain: BG
• Resolution: 6.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	S78 R83 K84	S77 R82 K83
BS02	rna	BG	K36 V38 N40 L43 G44 T71 K74 K75 N79 G89 R91 S124 D126 R128 N132 L133 G134 R136 R153 G154 M155 D156	K35 V37 N39 L42 G43 T70 K73 K74 N78 G88 R90 S123 D125 R127 N131 L132 G133 R135 R152 G153 M154 D155
BS03	rna	BG	N27 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R96	N26 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R95

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v68, PDBe:4v68, PDBj:4v68
• PDBsum: 4v68
• PubMed: 19229291
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)