Structure of PDB 4v5r Chain BG

Receptor sequence

>4v5rBG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v5r How Mutations in tRNA Distant from the Anticodon Affect the Fidelity of Decoding.
• Chain: BG
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	S76 S78 R83	S75 S77 R82
BS02	rna	BG	K36 V38 N40 G42 L43 T71 R72 A73 K75 N79 S124 R128 N130 N132 L133 G134 R136 G154 M155 D156 V160	K35 V37 N39 G41 L42 T70 R71 A72 K74 N78 S123 R127 N129 N131 L132 G133 R135 G153 M154 D155 V159
BS03	rna	BG	W29 E30 Q66 K67 P68 A69 R91 V92 T93 R95 R96	W28 E29 Q65 K66 P67 A68 R90 V91 T92 R94 R95

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v5r, PDBe:4v5r, PDBj:4v5r
• PDBsum: 4v5r
• PubMed: 21378964
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)