Structure of PDB 4v5a Chain BG

Receptor sequence
>4v5aBG (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK
3D structure
PDB4v5a Crystal structure of the ribosome recycling factor bound to the ribosome.
ChainBG
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna BG V38 N40 L43 T71 A73 K74 G89 S124 R128 N132 L135 R136 G154 M155 D156 V37 N39 L42 T70 A72 K73 G88 S123 R127 N131 L134 R135 G153 M154 D155
BS02 rna BG L3 N27 W29 E30 Q66 K67 P68 A69 V70 R91 V92 T93 R95 R96 L2 N26 W28 E29 Q65 K66 P67 A68 V69 R90 V91 T92 R94 R95
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v5a, PDBe:4v5a, PDBj:4v5a
PDBsum4v5a
PubMed17660830
UniProtQ5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]