Structure of PDB 4v4y Chain BG

Receptor sequence

>4v4yBG (length=182) Species: 300852 (Thermus thermophilus HB8)

MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDA
RILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMW
IFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVD
ALRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4v4y Structural basis for messenger RNA movement on the ribosome.
• Chain: BG
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	K81 L82 R83 K84	K81 L82 R83 K84
BS02	rna	BG	V38 N40 Q41 G42 L43 E45 A46 F80 R83 M86 I88 R91 D126 R128 N130 Y131 N132 L135 R136 R153 G154 M155 D156	V38 N40 Q41 G42 L43 E45 A46 F80 R83 M86 I88 R91 D126 R128 N130 Y131 N132 L135 R136 R153 G154 M155 D156
BS03	rna	BG	N27 W29 Q66 T93 L94 R95 R96 R98	N27 W29 Q66 T93 L94 R95 R96 R98

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4y, PDBe:4v4y, PDBj:4v4y
• PDBsum: 4v4y
• PubMed: 17051149
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)