Structure of PDB 4v4r Chain BG

Receptor sequence

>4v4rBG (length=122) Species: 274 (Thermus thermophilus)

FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHR

3D structure

• PDB: 4v4r Crystal Structures of the Ribosome in Complex with Release Factors RF1 and RF2 Bound to a Cognate Stop Codon.
• Chain: BG
• Resolution: 5.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BG	E12 M13 R17 Q47 M48 V50 T74 R76 R140 V141 R144 A147 S148 R149	E3 M4 R8 Q33 M34 V36 T60 R62 R106 V107 R110 A113 S114 R115
BS02	rna	BG	K20 V22 H24 M25 G26 I27 R51 T52 K53 K55 T57 K72 T74 D99 S105 F106 G107 L128 D129 N133 A142 K143 D145 S148 R149 S150 I151 R156	K11 V13 H15 M16 G17 I18 R37 T38 K39 K41 T43 K58 T60 D85 S91 F92 G93 L94 D95 N99 A108 K109 D111 S114 R115 S116 I117 R122

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4r, PDBe:4v4r, PDBj:4v4r
• PDBsum: 4v4r
• PubMed: 16377566
• UniProt: P14124|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)