Structure of PDB 9f1d Chain BF

Receptor sequence

>9f1dBF (length=226) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

RNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMA
RMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTF
VKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDN
TLIARSLGKYNIICMEDLIHEIYTVGKHFKEANNFLWPFKLSSPRGGMKK
KTTHFVEGGDAGNREDQINRLIRRMN

3D structure

PDB

9f1d NAC guides a ribosomal multienzyme complex for nascent protein processing.

Chain

Resolution

3.26 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	R22 F24 K28 I29 R31 R33 K34 F36 A37 R42 R45 K47 Y50 E51 H57 K58 Y60 R61 Y64 R65 I68 R69 R72 M73 R75 R95 G96 I97 N98 G99 P102 K106 L110 R112 Q115 I116 K123 A127 N130 L146 K147 N150 K155 R156 K164 R165 T172 A175 R176 G179 K180 I184 E187 K201 K211 L212 S213 S214 P215 R216 G217 G218 M219 K222 R241	R1 F3 K7 I8 R10 R12 K13 F15 A16 R21 R24 K26 Y29 E30 H36 K37 Y39 R40 Y43 R44 I47 R48 R51 M52 R54 R74 G75 I76 N77 G78 P81 K85 L89 R91 Q94 I95 K102 A106 N109 L125 K126 N129 K134 R135 K143 R144 T151 A154 R155 G158 K159 I163 E166 K180 K190 L191 S192 S193 P194 R195 G196 G197 M198 K201 R220
BS02	rna	BF	E136 T223 H225 V227 E228	E115 T202 H204 V206 E207

External links

PDB	RCSB:9f1d, PDBe:9f1d, PDBj:9f1d
PDBsum	9f1d
PubMed	39169182
UniProt	G1TUB1

[Back to BioLiP]