Structure of PDB 8q87 Chain BF

Receptor sequence

>8q87BF (length=234) Species: 9031 (Gallus gallus) [Search protein sequence]

PESLLKRRQAYAAAKAKRLKRLLAQKKFRKAQRKIIYERAKAYHKEYRHM
YRQEIRMARMARKAGNYYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRL
RQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVHDLIYKRGYGKINK
KRIALTDNSLIRKRLGKLGIICMEDVIHEIYTVGKNFKVVNNFLWPFKLS
SPRGGMKKKTIHFVEGGDAGNREDQINRLIRRMN

3D structure

PDB

8q87 Structural insights into inactive ribosome complexes derived from cold-treated chick embryo cells

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BF	S15 K18 R19 R20 A22 Y23 A26 K27 R30 R33 A36 F40 R41 R45 K46 Y49 E50 H56 K57 Y59 R60 H61 Y63 R64 Q65 I67 R68 R71 M72 R74 K75 A76 R94 G95 I96 N97 G98 P101 K102 K105 V106 L109 R111 Q114 I115 K122 K125 A126 N129 M130 I133 L145 K146 K154 R155 K159 N161 K162 K163 R164 R176 K179 L180 E186 K200 V201 N204 K210 L211 S212 S213 P214 R215 G216 G217 M218 K221 Q237 R240 R243	S3 K6 R7 R8 A10 Y11 A14 K15 R18 R21 A24 F28 R29 R33 K34 Y37 E38 H44 K45 Y47 R48 H49 Y51 R52 Q53 I55 R56 R59 M60 R62 K63 A64 R82 G83 I84 N85 G86 P89 K90 K93 V94 L97 R99 Q102 I103 K110 K113 A114 N117 M118 I121 L133 K134 K142 R143 K147 N149 K150 K151 R152 R164 K167 L168 E174 K188 V189 N192 K198 L199 S200 S201 P202 R203 G204 G205 M206 K209 Q225 R228 R231
BS02	rna	BF	R132 E135 P136 K220 T222 H224 E227	R120 E123 P124 K208 T210 H212 E215

External links

PDB	RCSB:8q87, PDBe:8q87, PDBj:8q87
PDBsum	8q87
PubMed
UniProt	Q5ZJ56\|RL7_CHICK Large ribosomal subunit protein uL30 (Gene Name=RPL7)

[Back to BioLiP]