Structure of PDB 8evt Chain BF

Receptor sequence

>8evtBF (length=206) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

FTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVDYVQVRQPIF
VAHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVRIIKHTLD
IINVLTDQNPIQVVVDAITNTGPREDTTRVGGGGAARRQAVDVSPLRRVN
QAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELER
VAKSNR

3D structure

PDB

8evt Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BF	M99 N100 R148 R166	M80 N81 R129 R147
BS02	rna	BF	T207 E216 R219 V220 K222 S223	T188 E197 R200 V201 K203 S204
BS03	A	BF	R102 F184 R185	R83 F165 R166
BS04	C	BF	F184 R185	F165 R166
BS05	U	BF	L97 R102 N103 K109 R180 T189 I190	L78 R83 N84 K90 R161 T170 I171
BS06	U	BF	R185 N186	R166 N167
BS07	G	BF	H72 M98	H53 M79
BS08	A	BF	N95 M98	N76 M79
BS09	U	BF	K84 R92 N169	K65 R73 N150
BS10	A	BF	K84 N169	K65 N150
BS11	C	BF	K80 R81	K61 R62
BS12	MG	BF	A183 N186 K188	A164 N167 K169

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8evt, PDBe:8evt, PDBj:8evt
PDBsum	8evt
PubMed	37595043
UniProt	A0A1L4AA68

[Back to BioLiP]