Structure of PDB 8evr Chain BF

Receptor sequence

>8evrBF (length=206) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

FTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVDYVQVRQPIF
VAHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVRIIKHTLD
IINVLTDQNPIQVVVDAITNTGPREDTTRVGGGGAARRQAVDVSPLRRVN
QAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELER
VAKSNR

3D structure

PDB

8evr Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	BF	N100 G101 R166	N81 G82 R147
BS02	rna	BF	L124 E196 K203 E216 R219 K222 S223	L105 E177 K184 E197 R200 K203 S204
BS03	A	BF	F184 R185	F165 R166
BS04	U	BF	N100 N103 T189 I190	N81 N84 T170 I171
BS05	C	BF	K106 K109	K87 K90
BS06	U	BF	L108 K109	L89 K90
BS07	U	BF	N186 I187	N167 I168
BS08	G	BF	H72 M98	H53 M79
BS09	U	BF	K84 R92 N169	K65 R73 N150
BS10	A	BF	K84 N169	K65 N150
BS11	U	BF	G105 K106	G86 K87

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8evr, PDBe:8evr, PDBj:8evr
PDBsum	8evr
PubMed	37595043
UniProt	A0A1L4AA68

[Back to BioLiP]